mirror of
https://github.com/pi-hole/pi-hole.git
synced 2024-11-24 07:03:43 +00:00
A black hole for Internet advertisements
ad-blockerblockerclouddashboarddhcpdhcp-serverdnsmasqdns-serverhacktoberfestpi-holeraspberry-pishell
46c1009aa8
What's new: - whitelist and blacklist bug fix - subdomains of items in whitelist are whitelisted too - subdomains of items in blacklist are blacklisted too - comments (lines starting with #) and blank lines are allowed in whitelist and in blacklist - definition of variables at the beginning of the code - smarter algorithm that reduces the number of entries in dnsmaq configuration file (i.e. if adsite.com is blocked there is no need to block www.adsite.com ad1.adsite.com whatever.adsite.com etc.) this reduce the number of entries in the output from ~ 140k down to ~ 92k. - domain list is sorted in reverse (right to left) order: TLD first, then domain name and subdomains at the end. |
||
---|---|---|
advanced | ||
automated install | ||
block hulu ads | ||
dnsmasq.conf | ||
gravity-adv.sh | ||
gravity.sh | ||
index.html | ||
LICENSE | ||
lighttpd.conf | ||
pihole.png | ||
README.md | ||
resolv.conf |
pi-hole
Raspberry Pi Ad Blocker (A black hole for ads, hence Pi-hole)